Placeholder image of a protein
Icon representing a puzzle

1308: Revisiting Puzzle 77: Copper Chaperone

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for CureCoin 21. CureCoin 1 pt. 8,090
  2. Avatar for Oxytocin 22. Oxytocin 1 pt. 8,077
  3. Avatar for Window Group 23. Window Group 1 pt. 6,731
  1. Avatar for reefyrob 31. reefyrob Lv 1 49 pts. 9,046
  2. Avatar for kabubi 32. kabubi Lv 1 48 pts. 9,044
  3. Avatar for pvc78 33. pvc78 Lv 1 47 pts. 9,037
  4. Avatar for drumpeter18yrs9yrs 34. drumpeter18yrs9yrs Lv 1 46 pts. 9,029
  5. Avatar for Marvelz 35. Marvelz Lv 1 45 pts. 9,020
  6. Avatar for eusair 36. eusair Lv 1 43 pts. 9,011
  7. Avatar for mimi 37. mimi Lv 1 42 pts. 9,011
  8. Avatar for johnmitch 38. johnmitch Lv 1 41 pts. 9,007
  9. Avatar for randomlil 39. randomlil Lv 1 40 pts. 9,003
  10. Avatar for jobo0502 40. jobo0502 Lv 1 39 pts. 9,000

Comments