1308: Revisiting Puzzle 77: Copper Chaperone

Closed since over 9 years ago

Summary

• Created: November 21, 2016
• Expires: November 29, 2016 at 23:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

• 1. Anthropic Dreams 100 pts. 9,196
• 2. Beta Folders 80 pts. 9,186
• 3. Gargleblasters 63 pts. 9,139
• 4. Go Science 49 pts. 9,126
• 5. Void Crushers 37 pts. 9,111
• 6. Contenders 28 pts. 9,103
• 7. L'Alliance Francophone 21 pts. 9,077
• 8. Deleted group pts. 9,054
• 9. Russian team 11 pts. 8,970
• 10. Eὕρηκα! Heureka! 8 pts. 8,945

Top soloists

• 31. reefyrob 49 pts. 9,046
• 32. kabubi 48 pts. 9,044
• 33. pvc78 47 pts. 9,037
• 34. drumpeter18yrs9yrs 46 pts. 9,029
• 35. Marvelz 45 pts. 9,020
• 36. eusair 43 pts. 9,011
• 37. mimi 42 pts. 9,011
• 38. johnmitch 41 pts. 9,007
• 39. randomlil 40 pts. 9,003
• 40. jobo0502 39 pts. 9,000