1308: Revisiting Puzzle 77: Copper Chaperone
Closed since over 9 years ago
Intermediate Overall PredictionSummary
- Created
- November 21, 2016
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI
Top groups
-
100 pts. 9,196
-
-
-
-
-
-
-
-
-