Placeholder image of a protein
Icon representing a puzzle

1314: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Prediction Prediction Prediction Prediction

Summary


Created
December 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,632
  2. Avatar for xkcd 12. xkcd 1 pt. 8,623
  3. Avatar for freefolder 13. freefolder 1 pt. 8,519
  4. Avatar for Russian team 14. Russian team 1 pt. 8,484
  5. Avatar for Deleted group 15. Deleted group pts. 8,464
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,459
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,014
  8. Avatar for Window Group 19. Window Group 1 pt. 3,942

  1. Avatar for dembones
    1. dembones Lv 1
    100 pts. 9,560
  2. Avatar for fiendish_ghoul 2. fiendish_ghoul Lv 1 98 pts. 9,559
  3. Avatar for LociOiling 3. LociOiling Lv 1 95 pts. 9,550
  4. Avatar for markm457 4. markm457 Lv 1 93 pts. 9,530
  5. Avatar for frood66 5. frood66 Lv 1 91 pts. 9,523
  6. Avatar for bertro 6. bertro Lv 1 88 pts. 9,499
  7. Avatar for Galaxie 7. Galaxie Lv 1 86 pts. 9,488
  8. Avatar for Aubade01 8. Aubade01 Lv 1 84 pts. 9,472
  9. Avatar for actiasluna 9. actiasluna Lv 1 82 pts. 9,472
  10. Avatar for pauldunn 10. pauldunn Lv 1 79 pts. 9,464

Comments