1314: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 9 years ago

Summary

• Created: December 06, 2016
• Expires: December 13, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

• 1. Contenders 100 pts. 9,570
• 2. Beta Folders 76 pts. 9,554
• 3. Gargleblasters 56 pts. 9,552
• 4. Anthropic Dreams 41 pts. 9,533
• 5. Go Science 29 pts. 9,464
• 6. HMT heritage 20 pts. 9,451
• 7. L'Alliance Francophone 14 pts. 9,399
• 8. Void Crushers 9 pts. 9,397
• 9. Italiani Al Lavoro 6 pts. 9,098
• 10. Deleted group pts. 8,784

Top soloists

• 1. dembones 100 pts. 9,560
• 2. fiendish_ghoul 98 pts. 9,559
• 3. LociOiling 95 pts. 9,550
• 4. markm457 93 pts. 9,530
• 5. frood66 91 pts. 9,523
• 6. bertro 88 pts. 9,499
• 7. Galaxie 86 pts. 9,488
• 8. Aubade01 84 pts. 9,472
• 9. actiasluna 82 pts. 9,472
• 10. pauldunn 79 pts. 9,464