1314: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 9 years ago

Summary

• Created: December 06, 2016
• Expires: December 13, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

• 1. Contenders 100 pts. 9,570
• 2. Beta Folders 76 pts. 9,554
• 3. Gargleblasters 56 pts. 9,552
• 4. Anthropic Dreams 41 pts. 9,533
• 5. Go Science 29 pts. 9,464
• 6. HMT heritage 20 pts. 9,451
• 7. L'Alliance Francophone 14 pts. 9,399
• 8. Void Crushers 9 pts. 9,397
• 9. Italiani Al Lavoro 6 pts. 9,098
• 10. Deleted group pts. 8,784

Top evolvers

• 1. Bletchley Park 100 pts. 9,570
• 2. gitwut 86 pts. 9,554
• 3. bertro 74 pts. 9,554
• 4. mimi 63 pts. 9,554
• 5. Blipperman 53 pts. 9,552
• 6. Skippysk8s 44 pts. 9,552
• 7. TomTaylor 37 pts. 9,550
• 8. smilingone 31 pts. 9,550
• 9. ManVsYard 25 pts. 9,548
• 10. retiredmichael 21 pts. 9,548