Placeholder image of a protein
Icon representing a puzzle

1314: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Contenders 100 pts. 9,570
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,554
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 9,552
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,533
  5. Avatar for Go Science 5. Go Science 29 pts. 9,464
  6. Avatar for HMT heritage 6. HMT heritage 20 pts. 9,451
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,399
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,397
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 6 pts. 9,098
  10. Avatar for Deleted group 10. Deleted group pts. 8,784

  1. Avatar for O Seki To 11. O Seki To Lv 1 77 pts. 9,451
  2. Avatar for johnmitch 12. johnmitch Lv 1 75 pts. 9,450
  3. Avatar for retiredmichael 13. retiredmichael Lv 1 73 pts. 9,447
  4. Avatar for reefyrob 14. reefyrob Lv 1 71 pts. 9,443
  5. Avatar for Deleted player 15. Deleted player pts. 9,442
  6. Avatar for Scopper 16. Scopper Lv 1 68 pts. 9,430
  7. Avatar for tokens 17. tokens Lv 1 66 pts. 9,423
  8. Avatar for gitwut 18. gitwut Lv 1 64 pts. 9,416
  9. Avatar for pvc78 19. pvc78 Lv 1 62 pts. 9,411
  10. Avatar for Bruno Kestemont 20. Bruno Kestemont Lv 1 60 pts. 9,410

Comments