Placeholder image of a protein
Icon representing a puzzle

1314: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Contenders 100 pts. 9,570
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,554
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 9,552
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,533
  5. Avatar for Go Science 5. Go Science 29 pts. 9,464
  6. Avatar for HMT heritage 6. HMT heritage 20 pts. 9,451
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,399
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,397
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 6 pts. 9,098
  10. Avatar for Deleted group 10. Deleted group pts. 8,784

  1. Avatar for ZeroLeak7 21. ZeroLeak7 Lv 1 59 pts. 9,405
  2. Avatar for nicobul 22. nicobul Lv 1 57 pts. 9,399
  3. Avatar for Timo van der Laan 23. Timo van der Laan Lv 1 55 pts. 9,397
  4. Avatar for Blipperman 24. Blipperman Lv 1 54 pts. 9,392
  5. Avatar for jobo0502 25. jobo0502 Lv 1 52 pts. 9,389
  6. Avatar for crpainter 26. crpainter Lv 1 51 pts. 9,378
  7. Avatar for eusair 27. eusair Lv 1 49 pts. 9,376
  8. Avatar for dcrwheeler 28. dcrwheeler Lv 1 48 pts. 9,363
  9. Avatar for mimi 29. mimi Lv 1 47 pts. 9,354
  10. Avatar for Bletchley Park 30. Bletchley Park Lv 1 45 pts. 9,339

Comments