Placeholder image of a protein
Icon representing a puzzle

1314: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 9 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Contenders 100 pts. 9,570
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,554
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 9,552
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,533
  5. Avatar for Go Science 5. Go Science 29 pts. 9,464
  6. Avatar for HMT heritage 6. HMT heritage 20 pts. 9,451
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,399
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,397
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 6 pts. 9,098
  10. Avatar for Deleted group 10. Deleted group pts. 8,784

  1. Avatar for stomjoh 51. stomjoh Lv 1 23 pts. 9,227
  2. Avatar for jamiexq 52. jamiexq Lv 1 22 pts. 9,219
  3. Avatar for alcor29 53. alcor29 Lv 1 22 pts. 9,193
  4. Avatar for caglar 54. caglar Lv 1 21 pts. 9,181
  5. Avatar for joremen 55. joremen Lv 1 20 pts. 9,180
  6. Avatar for Deleted player 56. Deleted player pts. 9,174
  7. Avatar for gurch 57. gurch Lv 1 19 pts. 9,158
  8. Avatar for tarimo 58. tarimo Lv 1 18 pts. 9,148
  9. Avatar for JayD7217 59. JayD7217 Lv 1 18 pts. 9,138
  10. Avatar for Norrjane 60. Norrjane Lv 1 17 pts. 9,128

Comments