Placeholder image of a protein
Icon representing a puzzle

1314: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
December 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,570
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,554
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 9,552
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,533
  5. Avatar for Go Science 5. Go Science 29 pts. 9,464
  6. Avatar for HMT heritage 6. HMT heritage 20 pts. 9,451
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,399
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,397
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 6 pts. 9,098
  10. Avatar for Deleted group 10. Deleted group pts. 8,784
  1. Avatar for Jumbly 111. Jumbly Lv 1 2 pts. 8,408
  2. Avatar for SaraL 112. SaraL Lv 1 2 pts. 8,373
  3. Avatar for JUMELLE54 113. JUMELLE54 Lv 1 2 pts. 8,341
  4. Avatar for anonycat 114. anonycat Lv 1 2 pts. 8,289
  5. Avatar for ruud891 115. ruud891 Lv 1 2 pts. 8,286
  6. Avatar for pizpot 116. pizpot Lv 1 2 pts. 8,258
  7. Avatar for hada 117. hada Lv 1 2 pts. 8,257
  8. Avatar for Altercomp 118. Altercomp Lv 1 2 pts. 8,256
  9. Avatar for pandapharmd 119. pandapharmd Lv 1 1 pt. 8,254
  10. Avatar for redguy 120. redguy Lv 1 1 pt. 8,251

Comments