Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,114
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,088
  3. Avatar for Russian team 13. Russian team 1 pt. 9,049
  4. Avatar for freefolder 14. freefolder 1 pt. 9,028
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 9,014
  6. Avatar for Freeport Honors Biology 16. Freeport Honors Biology 1 pt. 8,899
  7. Avatar for Deleted group 17. Deleted group pts. 8,732
  8. Avatar for R-MC Biochemistry 18. R-MC Biochemistry 1 pt. 8,449
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,293
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,060
  1. Avatar for kvasirthewise 121. kvasirthewise Lv 1 2 pts. 8,957
  2. Avatar for KingLear 122. KingLear Lv 1 2 pts. 8,940
  3. Avatar for rinze 123. rinze Lv 1 2 pts. 8,936
  4. Avatar for Sci1217 124. Sci1217 Lv 1 2 pts. 8,935
  5. Avatar for cherry39 125. cherry39 Lv 1 2 pts. 8,922
  6. Avatar for leehaggis 126. leehaggis Lv 1 2 pts. 8,917
  7. Avatar for bhfreagra 127. bhfreagra Lv 1 1 pt. 8,909
  8. Avatar for ThRob 128. ThRob Lv 1 1 pt. 8,899
  9. Avatar for Auntecedent 129. Auntecedent Lv 1 1 pt. 8,889
  10. Avatar for SouperGenious 130. SouperGenious Lv 1 1 pt. 8,882

Comments