Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for xkcd 11. xkcd 3 pts. 9,114
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,088
  3. Avatar for Russian team 13. Russian team 1 pt. 9,049
  4. Avatar for freefolder 14. freefolder 1 pt. 9,028
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 9,014
  6. Avatar for Deleted group 17. Deleted group pts. 8,732
  7. Avatar for R-MC Biochemistry 18. R-MC Biochemistry 1 pt. 8,449
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,293
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,060

  1. Avatar for Iron pet 131. Iron pet Lv 1 1 pt. 8,875
  2. Avatar for Cerzax 132. Cerzax Lv 1 1 pt. 8,875
  3. Avatar for DScott 133. DScott Lv 1 1 pt. 8,860
  4. Avatar for placid.lion 134. placid.lion Lv 1 1 pt. 8,857
  5. Avatar for altejoh 135. altejoh Lv 1 1 pt. 8,854
  6. Avatar for momadoc 136. momadoc Lv 1 1 pt. 8,833
  7. Avatar for pmelzer 137. pmelzer Lv 1 1 pt. 8,827
  8. Avatar for khendarg 138. khendarg Lv 1 1 pt. 8,820
  9. Avatar for badgoes 139. badgoes Lv 1 1 pt. 8,814
  10. Avatar for uihcv 140. uihcv Lv 1 1 pt. 8,784

Comments