1318: Revisiting Puzzle 81: Calcium Ion Binding Protein
Closed since about 9 years ago
Intermediate Overall PredictionSummary
- Created
- December 11, 2016
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK
