Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,114
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,088
  3. Avatar for Russian team 13. Russian team 1 pt. 9,049
  4. Avatar for freefolder 14. freefolder 1 pt. 9,028
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 9,014
  6. Avatar for Freeport Honors Biology 16. Freeport Honors Biology 1 pt. 8,899
  7. Avatar for Deleted group 17. Deleted group pts. 8,732
  8. Avatar for R-MC Biochemistry 18. R-MC Biochemistry 1 pt. 8,449
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,293
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,060
  1. Avatar for aspadistra 181. aspadistra Lv 1 1 pt. 8,060
  2. Avatar for Atrus_Homeboy 182. Atrus_Homeboy Lv 1 1 pt. 8,041
  3. Avatar for racingsnailrider 183. racingsnailrider Lv 1 1 pt. 8,015
  4. Avatar for heyubob 184. heyubob Lv 1 1 pt. 8,001
  5. Avatar for ivalnic 185. ivalnic Lv 1 1 pt. 7,990
  6. Avatar for karost 186. karost Lv 1 1 pt. 7,976
  7. Avatar for connorfeltonfraser 187. connorfeltonfraser Lv 1 1 pt. 7,958
  8. Avatar for FlaviuRadulescu 188. FlaviuRadulescu Lv 1 1 pt. 7,935
  9. Avatar for bob1928 189. bob1928 Lv 1 1 pt. 7,922
  10. Avatar for Kiwegapa 190. Kiwegapa Lv 1 1 pt. 7,905

Comments