Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for xkcd 11. xkcd 3 pts. 9,114
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,088
  3. Avatar for Russian team 13. Russian team 1 pt. 9,049
  4. Avatar for freefolder 14. freefolder 1 pt. 9,028
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 9,014
  6. Avatar for Deleted group 17. Deleted group pts. 8,732
  7. Avatar for R-MC Biochemistry 18. R-MC Biochemistry 1 pt. 8,449
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,293
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,060

  1. Avatar for Scopper 11. Scopper Lv 1 79 pts. 9,393
  2. Avatar for Timo van der Laan 12. Timo van der Laan Lv 1 77 pts. 9,384
  3. Avatar for reefyrob 13. reefyrob Lv 1 75 pts. 9,377
  4. Avatar for Deleted player 14. Deleted player pts. 9,370
  5. Avatar for Steven Pletsch 15. Steven Pletsch Lv 1 71 pts. 9,360
  6. Avatar for pauldunn 16. pauldunn Lv 1 69 pts. 9,349
  7. Avatar for ZeroLeak7 17. ZeroLeak7 Lv 1 68 pts. 9,334
  8. Avatar for Museka 18. Museka Lv 1 66 pts. 9,329
  9. Avatar for Galaxie 19. Galaxie Lv 1 64 pts. 9,323
  10. Avatar for Deleted player 20. Deleted player pts. 9,311

Comments