Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for xkcd 11. xkcd 3 pts. 9,114
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,088
  3. Avatar for Russian team 13. Russian team 1 pt. 9,049
  4. Avatar for freefolder 14. freefolder 1 pt. 9,028
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 9,014
  6. Avatar for Deleted group 17. Deleted group pts. 8,732
  7. Avatar for R-MC Biochemistry 18. R-MC Biochemistry 1 pt. 8,449
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,293
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,060

  1. Avatar for nkuehl2213 191. nkuehl2213 Lv 1 1 pt. 7,900
  2. Avatar for inkycatz 192. inkycatz Lv 1 1 pt. 7,864
  3. Avatar for blackfire34 193. blackfire34 Lv 1 1 pt. 7,842
  4. Avatar for Andres S. Rovalo 194. Andres S. Rovalo Lv 1 1 pt. 7,841
  5. Avatar for Susume 195. Susume Lv 1 1 pt. 7,708
  6. Avatar for courtneyetaylor 196. courtneyetaylor Lv 1 1 pt. 7,526
  7. Avatar for ScratchKid 197. ScratchKid Lv 1 1 pt. 7,518
  8. Avatar for akuk 198. akuk Lv 1 1 pt. 7,291
  9. Avatar for macastr9 199. macastr9 Lv 1 1 pt. 7,181
  10. Avatar for iceslayer 200. iceslayer Lv 1 1 pt. 5,461

Comments