Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,114
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,088
  3. Avatar for Russian team 13. Russian team 1 pt. 9,049
  4. Avatar for freefolder 14. freefolder 1 pt. 9,028
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 9,014
  6. Avatar for Freeport Honors Biology 16. Freeport Honors Biology 1 pt. 8,899
  7. Avatar for Deleted group 17. Deleted group pts. 8,732
  8. Avatar for R-MC Biochemistry 18. R-MC Biochemistry 1 pt. 8,449
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,293
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,060
  1. Avatar for fiendish_ghoul 21. fiendish_ghoul Lv 1 61 pts. 9,307
  2. Avatar for Deleted player 22. Deleted player pts. 9,302
  3. Avatar for bertro 23. bertro Lv 1 58 pts. 9,300
  4. Avatar for phi16 24. phi16 Lv 1 56 pts. 9,290
  5. Avatar for christioanchauvin 25. christioanchauvin Lv 1 55 pts. 9,285
  6. Avatar for g_b 26. g_b Lv 1 53 pts. 9,283
  7. Avatar for mimi 27. mimi Lv 1 52 pts. 9,281
  8. Avatar for crpainter 28. crpainter Lv 1 51 pts. 9,262
  9. Avatar for kabubi 29. kabubi Lv 1 49 pts. 9,257
  10. Avatar for pvc78 30. pvc78 Lv 1 48 pts. 9,254

Comments