Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary


Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for xkcd 11. xkcd 3 pts. 9,114
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,088
  3. Avatar for Russian team 13. Russian team 1 pt. 9,049
  4. Avatar for freefolder 14. freefolder 1 pt. 9,028
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 9,014
  6. Avatar for Deleted group 17. Deleted group pts. 8,732
  7. Avatar for R-MC Biochemistry 18. R-MC Biochemistry 1 pt. 8,449
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,293
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,060

  1. Avatar for Vinara 51. Vinara Lv 1 26 pts. 9,162
  2. Avatar for Glen B 52. Glen B Lv 1 25 pts. 9,158
  3. Avatar for georg137 53. georg137 Lv 1 24 pts. 9,156
  4. Avatar for manu8170 54. manu8170 Lv 1 24 pts. 9,153
  5. Avatar for tallguy-13088 55. tallguy-13088 Lv 1 23 pts. 9,152
  6. Avatar for johngran 56. johngran Lv 1 22 pts. 9,151
  7. Avatar for tarimo 57. tarimo Lv 1 22 pts. 9,151
  8. Avatar for dbuskeirc2 58. dbuskeirc2 Lv 1 21 pts. 9,150
  9. Avatar for hansvandenhof 59. hansvandenhof Lv 1 20 pts. 9,149
  10. Avatar for cobaltteal 60. cobaltteal Lv 1 20 pts. 9,147

Comments