Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for xkcd 11. xkcd 3 pts. 9,114
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,088
  3. Avatar for Russian team 13. Russian team 1 pt. 9,049
  4. Avatar for freefolder 14. freefolder 1 pt. 9,028
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 9,014
  6. Avatar for Freeport Honors Biology 16. Freeport Honors Biology 1 pt. 8,899
  7. Avatar for Deleted group 17. Deleted group pts. 8,732
  8. Avatar for R-MC Biochemistry 18. R-MC Biochemistry 1 pt. 8,449
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,293
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,060
  1. Avatar for randomlil 71. randomlil Lv 1 14 pts. 9,121
  2. Avatar for machinelves 72. machinelves Lv 1 13 pts. 9,120
  3. Avatar for Superphosphate 73. Superphosphate Lv 1 13 pts. 9,117
  4. Avatar for fryguy 74. fryguy Lv 1 12 pts. 9,114
  5. Avatar for Keresto 75. Keresto Lv 1 12 pts. 9,109
  6. Avatar for diamonddays 76. diamonddays Lv 1 11 pts. 9,103
  7. Avatar for shettler 77. shettler Lv 1 11 pts. 9,100
  8. Avatar for pfirth 78. pfirth Lv 1 11 pts. 9,096
  9. Avatar for SaraL 79. SaraL Lv 1 10 pts. 9,096
  10. Avatar for weitzen 80. weitzen Lv 1 10 pts. 9,092

Comments