Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,490
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,471
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,453
  4. Avatar for Contenders 4. Contenders 43 pts. 9,439
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 9,403
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,384
  7. Avatar for Deleted group 7. Deleted group pts. 9,360
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 9,312
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,192
  10. Avatar for :) 10. :) 5 pts. 9,120
  1. Avatar for Deleted player 21. Deleted player pts. 9,312
  2. Avatar for Skippysk8s 22. Skippysk8s Lv 1 1 pt. 9,309
  3. Avatar for ManVsYard 23. ManVsYard Lv 1 1 pt. 9,304
  4. Avatar for Fat Tony 24. Fat Tony Lv 1 1 pt. 9,303
  5. Avatar for actiasluna 25. actiasluna Lv 1 1 pt. 9,303
  6. Avatar for SaraL 26. SaraL Lv 1 1 pt. 9,301
  7. Avatar for smholst 27. smholst Lv 1 1 pt. 9,300
  8. Avatar for dbuskeirc2 28. dbuskeirc2 Lv 1 1 pt. 9,212
  9. Avatar for Keresto 29. Keresto Lv 1 1 pt. 9,160
  10. Avatar for MikeCassidytoo 30. MikeCassidytoo Lv 1 1 pt. 8,821

Comments