Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,490
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,471
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,453
  4. Avatar for Contenders 4. Contenders 43 pts. 9,439
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 9,403
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,384
  7. Avatar for Deleted group 7. Deleted group pts. 9,360
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 9,312
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,192
  10. Avatar for :) 10. :) 5 pts. 9,120
  1. Avatar for parsnip 161. parsnip Lv 1 1 pt. 8,461
  2. Avatar for GPeakRMC 162. GPeakRMC Lv 1 1 pt. 8,449
  3. Avatar for Aricot 163. Aricot Lv 1 1 pt. 8,433
  4. Avatar for hc820080 164. hc820080 Lv 1 1 pt. 8,405
  5. Avatar for mindleaving 165. mindleaving Lv 1 1 pt. 8,404
  6. Avatar for rabetty 166. rabetty Lv 1 1 pt. 8,400
  7. Avatar for AlphaSniper 167. AlphaSniper Lv 1 1 pt. 8,396
  8. Avatar for Pietro MSB 168. Pietro MSB Lv 1 1 pt. 8,393
  9. Avatar for paulsomerville1963@outlook.com 169. paulsomerville1963@outlook.com Lv 1 1 pt. 8,391
  10. Avatar for NotJim99 170. NotJim99 Lv 1 1 pt. 8,383

Comments