Placeholder image of a protein
Icon representing a puzzle

1318: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 11, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,490
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,471
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 9,453
  4. Avatar for Contenders 4. Contenders 43 pts. 9,439
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 9,403
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,384
  7. Avatar for Deleted group 7. Deleted group pts. 9,360
  8. Avatar for Gargleblasters 8. Gargleblasters 11 pts. 9,312
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,192
  10. Avatar for :) 10. :) 5 pts. 9,120
  1. Avatar for Olinator93 201. Olinator93 Lv 1 1 pt. 4,709
  2. Avatar for Bletchley Park 202. Bletchley Park Lv 1 1 pt. 4,709
  3. Avatar for ralan-nsk 203. ralan-nsk Lv 1 1 pt. 4,709
  4. Avatar for saksoft2 204. saksoft2 Lv 1 1 pt. 4,709
  5. Avatar for sarlamea 205. sarlamea Lv 1 1 pt. 4,709
  6. Avatar for MikeCassidytoo 206. MikeCassidytoo Lv 1 1 pt. 4,709
  7. Avatar for froggs554 207. froggs554 Lv 1 1 pt. 4,709
  8. Avatar for dbuske 208. dbuske Lv 1 1 pt. 4,709
  9. Avatar for SWR_DMaster 209. SWR_DMaster Lv 1 1 pt. 4,709
  10. Avatar for Paulo Roque 210. Paulo Roque Lv 1 1 pt. 4,709

Comments