Placeholder image of a protein
Icon representing a puzzle

1320: Revisiting Puzzle 82: Cytotoxin

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Piratenpartei Deutschland 11. Piratenpartei Deutschland 2 pts. 8,976
  2. Avatar for Kotocycle 12. Kotocycle 1 pt. 8,813
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,425
  4. Avatar for freefolder 14. freefolder 1 pt. 8,318
  5. Avatar for xkcd 15. xkcd 1 pt. 8,123
  6. Avatar for :) 16. :) 1 pt. 8,110
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 8,027
  8. Avatar for Russian team 18. Russian team 1 pt. 7,883
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,732
  1. Avatar for bhfreagra 151. bhfreagra Lv 1 1 pt. 8,055
  2. Avatar for cnhrcolemam 152. cnhrcolemam Lv 1 1 pt. 8,034
  3. Avatar for Auntecedent 153. Auntecedent Lv 1 1 pt. 8,033
  4. Avatar for aspadistra 154. aspadistra Lv 1 1 pt. 8,027
  5. Avatar for pizpot 155. pizpot Lv 1 1 pt. 7,988
  6. Avatar for robinsont511 156. robinsont511 Lv 1 1 pt. 7,970
  7. Avatar for dldahlen 157. dldahlen Lv 1 1 pt. 7,967
  8. Avatar for lamoille 158. lamoille Lv 1 1 pt. 7,886
  9. Avatar for ralan-nsk 159. ralan-nsk Lv 1 1 pt. 7,883
  10. Avatar for Merf 160. Merf Lv 1 1 pt. 7,870

Comments