Placeholder image of a protein
Icon representing a puzzle

1320: Revisiting Puzzle 82: Cytotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,701
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 9,691
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 9,645
  4. Avatar for Void Crushers 4. Void Crushers 41 pts. 9,644
  5. Avatar for Go Science 5. Go Science 29 pts. 9,642
  6. Avatar for Contenders 6. Contenders 20 pts. 9,609
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,536
  8. Avatar for Deleted group 8. Deleted group pts. 9,531
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 6 pts. 9,248
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,227
  1. Avatar for bhfreagra 151. bhfreagra Lv 1 1 pt. 8,055
  2. Avatar for cnhrcolemam 152. cnhrcolemam Lv 1 1 pt. 8,034
  3. Avatar for Auntecedent 153. Auntecedent Lv 1 1 pt. 8,033
  4. Avatar for aspadistra 154. aspadistra Lv 1 1 pt. 8,027
  5. Avatar for pizpot 155. pizpot Lv 1 1 pt. 7,988
  6. Avatar for robinsont511 156. robinsont511 Lv 1 1 pt. 7,970
  7. Avatar for dldahlen 157. dldahlen Lv 1 1 pt. 7,967
  8. Avatar for lamoille 158. lamoille Lv 1 1 pt. 7,886
  9. Avatar for ralan-nsk 159. ralan-nsk Lv 1 1 pt. 7,883
  10. Avatar for Merf 160. Merf Lv 1 1 pt. 7,870

Comments