Placeholder image of a protein
Icon representing a puzzle

1320: Revisiting Puzzle 82: Cytotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
December 20, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,701
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 9,691
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 9,645
  4. Avatar for Void Crushers 4. Void Crushers 41 pts. 9,644
  5. Avatar for Go Science 5. Go Science 29 pts. 9,642
  6. Avatar for Contenders 6. Contenders 20 pts. 9,609
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,536
  8. Avatar for Deleted group 8. Deleted group pts. 9,531
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 6 pts. 9,248
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,227

  1. Avatar for Andres S. Rovalo 171. Andres S. Rovalo Lv 1 1 pt. 7,714
  2. Avatar for damino11 172. damino11 Lv 1 1 pt. 7,712
  3. Avatar for asperger1993 173. asperger1993 Lv 1 1 pt. 7,698
  4. Avatar for Moamen 174. Moamen Lv 1 1 pt. 7,687
  5. Avatar for dam_01 175. dam_01 Lv 1 1 pt. 7,678
  6. Avatar for trentis1 176. trentis1 Lv 1 1 pt. 7,673
  7. Avatar for pegasevil 177. pegasevil Lv 1 1 pt. 7,672
  8. Avatar for GlowingCurium96 178. GlowingCurium96 Lv 1 1 pt. 7,658
  9. Avatar for 1306148 179. 1306148 Lv 1 1 pt. 7,655
  10. Avatar for marcomi8 180. marcomi8 Lv 1 1 pt. 7,640

Comments