Placeholder image of a protein
Icon representing a puzzle

1323: Unsolved De-novo Freestyle 94

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
December 30, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEERKKEIQKEIEKIKEWFKEGQHHRRLEIRIDEHDIEIEVEIRQDHLRIRLRNVDEELKKEFEKLKEEWKKLQE

Top groups


  1. Avatar for Team South Africa 12. Team South Africa 1 pt. 8,413
  2. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,370
  3. Avatar for freefolder 14. freefolder 1 pt. 7,874
  4. Avatar for HTCMS Mr Cardo Class 15. HTCMS Mr Cardo Class 1 pt. 6,609
  5. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 4,372

  1. Avatar for froggs554 81. froggs554 Lv 1 4 pts. 8,781
  2. Avatar for Ikuso 82. Ikuso Lv 1 3 pts. 8,772
  3. Avatar for Deleted player 83. Deleted player pts. 8,754
  4. Avatar for versat82 84. versat82 Lv 1 3 pts. 8,754
  5. Avatar for jackie123 85. jackie123 Lv 1 3 pts. 8,746
  6. Avatar for smholst 86. smholst Lv 1 3 pts. 8,664
  7. Avatar for senor pit 87. senor pit Lv 1 3 pts. 8,654
  8. Avatar for jamiexq 88. jamiexq Lv 1 2 pts. 8,620
  9. Avatar for placid.lion 89. placid.lion Lv 1 2 pts. 8,593
  10. Avatar for Bletchley Park 90. Bletchley Park Lv 1 2 pts. 8,584

Comments