Placeholder image of a protein
Icon representing a puzzle

1323: Unsolved De-novo Freestyle 94

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 30, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEERKKEIQKEIEKIKEWFKEGQHHRRLEIRIDEHDIEIEVEIRQDHLRIRLRNVDEELKKEFEKLKEEWKKLQE

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,647
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 9,602
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,580
  4. Avatar for Go Science 4. Go Science 33 pts. 9,574
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,502
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,452
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,299
  8. Avatar for Deleted group 8. Deleted group pts. 9,222
  9. Avatar for xkcd 9. xkcd 3 pts. 9,024
  10. Avatar for Kotocycle 10. Kotocycle 2 pts. 8,772
  1. Avatar for Vredeman 11. Vredeman Lv 1 73 pts. 9,455
  2. Avatar for actiasluna 12. actiasluna Lv 1 71 pts. 9,452
  3. Avatar for Susume 13. Susume Lv 1 68 pts. 9,446
  4. Avatar for jermainiac 14. jermainiac Lv 1 66 pts. 9,435
  5. Avatar for frood66 15. frood66 Lv 1 64 pts. 9,425
  6. Avatar for spvincent 16. spvincent Lv 1 62 pts. 9,414
  7. Avatar for retiredmichael 17. retiredmichael Lv 1 60 pts. 9,409
  8. Avatar for markm457 18. markm457 Lv 1 58 pts. 9,376
  9. Avatar for alcor29 19. alcor29 Lv 1 56 pts. 9,324
  10. Avatar for spmm 20. spmm Lv 1 54 pts. 9,311

Comments