Placeholder image of a protein
Icon representing a puzzle

1323: Unsolved De-novo Freestyle 94

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
December 30, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEERKKEIQKEIEKIKEWFKEGQHHRRLEIRIDEHDIEIEVEIRQDHLRIRLRNVDEELKKEFEKLKEEWKKLQE

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,647
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 9,602
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,580
  4. Avatar for Go Science 4. Go Science 33 pts. 9,574
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,502
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,452
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,299
  8. Avatar for Deleted group 8. Deleted group pts. 9,222
  9. Avatar for xkcd 9. xkcd 3 pts. 9,024
  10. Avatar for Kotocycle 10. Kotocycle 2 pts. 8,772
  1. Avatar for hpaege 41. hpaege Lv 1 24 pts. 9,200
  2. Avatar for dcrwheeler 42. dcrwheeler Lv 1 23 pts. 9,199
  3. Avatar for johnmitch 43. johnmitch Lv 1 22 pts. 9,196
  4. Avatar for TastyMunchies 44. TastyMunchies Lv 1 21 pts. 9,184
  5. Avatar for nicobul 45. nicobul Lv 1 21 pts. 9,179
  6. Avatar for alwen 46. alwen Lv 1 20 pts. 9,175
  7. Avatar for Anfinsen_slept_here 47. Anfinsen_slept_here Lv 1 19 pts. 9,158
  8. Avatar for caglar 48. caglar Lv 1 18 pts. 9,151
  9. Avatar for Blipperman 49. Blipperman Lv 1 17 pts. 9,147
  10. Avatar for crpainter 50. crpainter Lv 1 17 pts. 9,112

Comments