Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,793
  2. Avatar for Team Mexico 12. Team Mexico 1 pt. 8,365
  3. Avatar for freefolder 13. freefolder 1 pt. 8,225
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,859
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 7,436
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,300

  1. Avatar for SaraL 131. SaraL Lv 1 1 pt. 7,906
  2. Avatar for AeonFluff 132. AeonFluff Lv 1 1 pt. 7,889
  3. Avatar for martinf 133. martinf Lv 1 1 pt. 7,871
  4. Avatar for doctaven 134. doctaven Lv 1 1 pt. 7,859
  5. Avatar for jackie123 135. jackie123 Lv 1 1 pt. 7,839
  6. Avatar for feand 136. feand Lv 1 1 pt. 7,832
  7. Avatar for umisuke 137. umisuke Lv 1 1 pt. 7,814
  8. Avatar for Moamen 138. Moamen Lv 1 1 pt. 7,747
  9. Avatar for lamoille 139. lamoille Lv 1 1 pt. 7,738
  10. Avatar for JohnCena 140. JohnCena Lv 1 1 pt. 7,738

Comments


bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN