Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,624
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,624
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,599
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 36 pts. 9,582
  5. Avatar for Go Science 5. Go Science 24 pts. 9,579
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,569
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,543
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 6 pts. 9,230
  9. Avatar for Deleted group 9. Deleted group pts. 9,020
  10. Avatar for xkcd 10. xkcd 2 pts. 8,891
  1. Avatar for SaraL 131. SaraL Lv 1 1 pt. 7,906
  2. Avatar for AeonFluff 132. AeonFluff Lv 1 1 pt. 7,889
  3. Avatar for martinf 133. martinf Lv 1 1 pt. 7,871
  4. Avatar for doctaven 134. doctaven Lv 1 1 pt. 7,859
  5. Avatar for jackie123 135. jackie123 Lv 1 1 pt. 7,839
  6. Avatar for feand 136. feand Lv 1 1 pt. 7,832
  7. Avatar for umisuke 137. umisuke Lv 1 1 pt. 7,814
  8. Avatar for Moamen 138. Moamen Lv 1 1 pt. 7,747
  9. Avatar for lamoille 139. lamoille Lv 1 1 pt. 7,738
  10. Avatar for JohnCena 140. JohnCena Lv 1 1 pt. 7,738

Comments

bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN