Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,793
  2. Avatar for Team Mexico 12. Team Mexico 1 pt. 8,365
  3. Avatar for freefolder 13. freefolder 1 pt. 8,225
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 7,859
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 7,436
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 7,300
  7. Avatar for HTCMS Mr Cardo Class 17. HTCMS Mr Cardo Class 1 pt. 193
  1. Avatar for LavenderSky 161. LavenderSky Lv 1 1 pt. 7,418
  2. Avatar for j_terw01 162. j_terw01 Lv 1 1 pt. 7,389
  3. Avatar for MaticUrlep 163. MaticUrlep Lv 1 1 pt. 7,320
  4. Avatar for aspadistra 164. aspadistra Lv 1 1 pt. 7,300
  5. Avatar for emailfelix 165. emailfelix Lv 1 1 pt. 7,179
  6. Avatar for smholst 166. smholst Lv 1 1 pt. 7,100
  7. Avatar for jwu1234567890 167. jwu1234567890 Lv 1 1 pt. 7,078
  8. Avatar for jswon 168. jswon Lv 1 1 pt. 7,009
  9. Avatar for Vasiles 169. Vasiles Lv 1 1 pt. 6,894
  10. Avatar for Hollinas 170. Hollinas Lv 1 1 pt. 193

Comments

bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN