Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Contenders 100 pts. 9,624
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,624
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,599
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 36 pts. 9,582
  5. Avatar for Go Science 5. Go Science 24 pts. 9,579
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,569
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,543
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 6 pts. 9,230
  9. Avatar for Deleted group 9. Deleted group pts. 9,020
  10. Avatar for xkcd 10. xkcd 2 pts. 8,891

  1. Avatar for LavenderSky 161. LavenderSky Lv 1 1 pt. 7,418
  2. Avatar for j_terw01 162. j_terw01 Lv 1 1 pt. 7,389
  3. Avatar for MaticUrlep 163. MaticUrlep Lv 1 1 pt. 7,320
  4. Avatar for aspadistra 164. aspadistra Lv 1 1 pt. 7,300
  5. Avatar for emailfelix 165. emailfelix Lv 1 1 pt. 7,179
  6. Avatar for smholst 166. smholst Lv 1 1 pt. 7,100
  7. Avatar for jwu1234567890 167. jwu1234567890 Lv 1 1 pt. 7,078
  8. Avatar for jswon 168. jswon Lv 1 1 pt. 7,009
  9. Avatar for Vasiles 169. Vasiles Lv 1 1 pt. 6,894
  10. Avatar for Hollinas 170. Hollinas Lv 1 1 pt. 193

Comments


bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN