Placeholder image of a protein
Icon representing a puzzle

1326: Unsolved De-novo Freestyle 95

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TDDFREELKKMLKEYKRHSQEHYRSSRSTDDGRTSTEVRYDHDNGTSEVRSTSDNGDEEIRKQLKEMKKELKKQG

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,723
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 8,248
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 7,223
  4. Avatar for Deleted group 14. Deleted group pts. 7,124
  5. Avatar for HTCMS Mr Cardo Class 15. HTCMS Mr Cardo Class 1 pt. 6,396
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 0

  1. Avatar for momadoc 101. momadoc Lv 1 2 pts. 8,680
  2. Avatar for martin.szew 102. martin.szew Lv 1 2 pts. 8,680
  3. Avatar for JUMELLE54 103. JUMELLE54 Lv 1 2 pts. 8,677
  4. Avatar for ViJay7019 104. ViJay7019 Lv 1 2 pts. 8,668
  5. Avatar for MicElephant 105. MicElephant Lv 1 2 pts. 8,661
  6. Avatar for Cerzax 106. Cerzax Lv 1 1 pt. 8,632
  7. Avatar for khendarg 107. khendarg Lv 1 1 pt. 8,617
  8. Avatar for SKSbell 108. SKSbell Lv 1 1 pt. 8,605
  9. Avatar for joaniegirl 109. joaniegirl Lv 1 1 pt. 8,603
  10. Avatar for dbuske 110. dbuske Lv 1 1 pt. 8,593

Comments