Placeholder image of a protein
Icon representing a puzzle

1326: Unsolved De-novo Freestyle 95

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TDDFREELKKMLKEYKRHSQEHYRSSRSTDDGRTSTEVRYDHDNGTSEVRSTSDNGDEEIRKQLKEMKKELKKQG

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,723
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 8,248
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 7,223
  4. Avatar for Deleted group 14. Deleted group pts. 7,124
  5. Avatar for HTCMS Mr Cardo Class 15. HTCMS Mr Cardo Class 1 pt. 6,396
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 0
  1. Avatar for CharlieFortsConscience 41. CharlieFortsConscience Lv 1 27 pts. 9,154
  2. Avatar for justjustin 42. justjustin Lv 1 26 pts. 9,149
  3. Avatar for Mike Cassidy 43. Mike Cassidy Lv 1 25 pts. 9,148
  4. Avatar for Timo van der Laan 44. Timo van der Laan Lv 1 24 pts. 9,141
  5. Avatar for Scopper 45. Scopper Lv 1 24 pts. 9,134
  6. Avatar for Bautho 46. Bautho Lv 1 23 pts. 9,131
  7. Avatar for spvincent 47. spvincent Lv 1 22 pts. 9,128
  8. Avatar for WBarme1234 48. WBarme1234 Lv 1 21 pts. 9,128
  9. Avatar for pvc78 49. pvc78 Lv 1 20 pts. 9,124
  10. Avatar for stomjoh 50. stomjoh Lv 1 19 pts. 9,112

Comments