Placeholder image of a protein
Icon representing a puzzle

1326: Unsolved De-novo Freestyle 95

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TDDFREELKKMLKEYKRHSQEHYRSSRSTDDGRTSTEVRYDHDNGTSEVRSTSDNGDEEIRKQLKEMKKELKKQG

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,723
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 8,248
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 7,223
  4. Avatar for Deleted group 14. Deleted group pts. 7,124
  5. Avatar for HTCMS Mr Cardo Class 15. HTCMS Mr Cardo Class 1 pt. 6,396
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 0
  1. Avatar for alcor29 51. alcor29 Lv 1 19 pts. 9,111
  2. Avatar for georg137 52. georg137 Lv 1 18 pts. 9,098
  3. Avatar for saksoft2 53. saksoft2 Lv 1 17 pts. 9,096
  4. Avatar for TastyMunchies 54. TastyMunchies Lv 1 17 pts. 9,087
  5. Avatar for guineapig 55. guineapig Lv 1 16 pts. 9,085
  6. Avatar for Vinara 56. Vinara Lv 1 15 pts. 9,079
  7. Avatar for gurch 57. gurch Lv 1 15 pts. 9,075
  8. Avatar for isaksson 58. isaksson Lv 1 14 pts. 9,068
  9. Avatar for fishercat 59. fishercat Lv 1 13 pts. 9,055
  10. Avatar for hpaege 60. hpaege Lv 1 13 pts. 9,053

Comments