Placeholder image of a protein
Icon representing a puzzle

1326: Unsolved De-novo Freestyle 95

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TDDFREELKKMLKEYKRHSQEHYRSSRSTDDGRTSTEVRYDHDNGTSEVRSTSDNGDEEIRKQLKEMKKELKKQG

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 8,723
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 8,248
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 1 pt. 7,223
  4. Avatar for Deleted group 14. Deleted group pts. 7,124
  5. Avatar for HTCMS Mr Cardo Class 15. HTCMS Mr Cardo Class 1 pt. 6,396
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 0
  1. Avatar for deLaCeiba 81. deLaCeiba Lv 1 5 pts. 8,853
  2. Avatar for Jim Fraser 82. Jim Fraser Lv 1 5 pts. 8,845
  3. Avatar for hansvandenhof 83. hansvandenhof Lv 1 5 pts. 8,841
  4. Avatar for diamonddays 84. diamonddays Lv 1 4 pts. 8,834
  5. Avatar for Randolph_M_Snyder 85. Randolph_M_Snyder Lv 1 4 pts. 8,818
  6. Avatar for pfirth 86. pfirth Lv 1 4 pts. 8,811
  7. Avatar for FishKAA 87. FishKAA Lv 1 4 pts. 8,795
  8. Avatar for YGK 88. YGK Lv 1 4 pts. 8,783
  9. Avatar for tallguy-13088 89. tallguy-13088 Lv 1 3 pts. 8,781
  10. Avatar for cbwest 90. cbwest Lv 1 3 pts. 8,775

Comments