Placeholder image of a protein
Icon representing a puzzle

1326: Unsolved De-novo Freestyle 95

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TDDFREELKKMLKEYKRHSQEHYRSSRSTDDGRTSTEVRYDHDNGTSEVRSTSDNGDEEIRKQLKEMKKELKKQG

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,451
  2. Avatar for Go Science 2. Go Science 71 pts. 9,412
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,401
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,367
  5. Avatar for Contenders 5. Contenders 22 pts. 9,356
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 9,352
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,174
  8. Avatar for xkcd 8. xkcd 5 pts. 9,048
  9. Avatar for Deleted group 9. Deleted group pts. 9,032
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,913
  1. Avatar for NinjaGreg 21. NinjaGreg Lv 1 55 pts. 9,280
  2. Avatar for johnmitch 22. johnmitch Lv 1 53 pts. 9,260
  3. Avatar for LociOiling 23. LociOiling Lv 1 51 pts. 9,251
  4. Avatar for Blipperman 24. Blipperman Lv 1 50 pts. 9,251
  5. Avatar for dcrwheeler 25. dcrwheeler Lv 1 48 pts. 9,249
  6. Avatar for froggs554 26. froggs554 Lv 1 46 pts. 9,247
  7. Avatar for reefyrob 27. reefyrob Lv 1 45 pts. 9,238
  8. Avatar for TomTaylor 28. TomTaylor Lv 1 43 pts. 9,226
  9. Avatar for Deleted player 29. Deleted player pts. 9,224
  10. Avatar for christioanchauvin 30. christioanchauvin Lv 1 40 pts. 9,213

Comments