Placeholder image of a protein
Icon representing a puzzle

1326: Unsolved De-novo Freestyle 95

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TDDFREELKKMLKEYKRHSQEHYRSSRSTDDGRTSTEVRYDHDNGTSEVRSTSDNGDEEIRKQLKEMKKELKKQG

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,451
  2. Avatar for Go Science 2. Go Science 71 pts. 9,412
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 9,401
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,367
  5. Avatar for Contenders 5. Contenders 22 pts. 9,356
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 9,352
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,174
  8. Avatar for xkcd 8. xkcd 5 pts. 9,048
  9. Avatar for Deleted group 9. Deleted group pts. 9,032
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,913

  1. Avatar for fryguy 61. fryguy Lv 1 12 pts. 9,048
  2. Avatar for heather-1 62. heather-1 Lv 1 12 pts. 9,046
  3. Avatar for Anfinsen_slept_here 63. Anfinsen_slept_here Lv 1 11 pts. 9,039
  4. Avatar for drumpeter18yrs9yrs 64. drumpeter18yrs9yrs Lv 1 11 pts. 9,032
  5. Avatar for frood66 65. frood66 Lv 1 10 pts. 9,031
  6. Avatar for Bletchley Park 66. Bletchley Park Lv 1 10 pts. 9,031
  7. Avatar for alwen 67. alwen Lv 1 10 pts. 9,024
  8. Avatar for Psych0Active 68. Psych0Active Lv 1 9 pts. 9,023
  9. Avatar for harvardman 69. harvardman Lv 1 9 pts. 9,018
  10. Avatar for mitarcher 70. mitarcher Lv 1 8 pts. 8,994

Comments