Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 7,353
  2. Avatar for Window Group 22. Window Group 1 pt. 4,069

  1. Avatar for lupussapien 91. lupussapien Lv 1 4 pts. 8,522
  2. Avatar for ZiiONIC 92. ZiiONIC Lv 1 4 pts. 8,515
  3. Avatar for SouperGenious 93. SouperGenious Lv 1 4 pts. 8,498
  4. Avatar for fryguy 94. fryguy Lv 1 4 pts. 8,489
  5. Avatar for fishercat 95. fishercat Lv 1 4 pts. 8,483
  6. Avatar for harvardman 96. harvardman Lv 1 3 pts. 8,464
  7. Avatar for Psych0Active 97. Psych0Active Lv 1 3 pts. 8,449
  8. Avatar for SaraL 98. SaraL Lv 1 3 pts. 8,446
  9. Avatar for khendarg 99. khendarg Lv 1 3 pts. 8,429
  10. Avatar for TastyMunchies 100. TastyMunchies Lv 1 3 pts. 8,416

Comments