Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 7,353
  2. Avatar for Window Group 22. Window Group 1 pt. 4,069

  1. Avatar for JUMELLE54 101. JUMELLE54 Lv 1 3 pts. 8,402
  2. Avatar for Simek 102. Simek Lv 1 3 pts. 8,391
  3. Avatar for joaniegirl 103. joaniegirl Lv 1 2 pts. 8,375
  4. Avatar for stephen.r.lewis86 104. stephen.r.lewis86 Lv 1 2 pts. 8,375
  5. Avatar for DScott 105. DScott Lv 1 2 pts. 8,363
  6. Avatar for Mr_Jolty 106. Mr_Jolty Lv 1 2 pts. 8,353
  7. Avatar for weitzen 107. weitzen Lv 1 2 pts. 8,332
  8. Avatar for jfryk 108. jfryk Lv 1 2 pts. 8,330
  9. Avatar for manu8170 109. manu8170 Lv 1 2 pts. 8,288
  10. Avatar for drising 110. drising Lv 1 2 pts. 8,282

Comments