Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 7,353
  2. Avatar for Window Group 22. Window Group 1 pt. 4,069

  1. Avatar for rinze 111. rinze Lv 1 2 pts. 8,262
  2. Avatar for anonycat 112. anonycat Lv 1 2 pts. 8,253
  3. Avatar for kitek314_pl 113. kitek314_pl Lv 1 2 pts. 8,247
  4. Avatar for Arne Heessels 114. Arne Heessels Lv 1 1 pt. 8,238
  5. Avatar for mitarcher 115. mitarcher Lv 1 1 pt. 8,224
  6. Avatar for heyubob 116. heyubob Lv 1 1 pt. 8,221
  7. Avatar for navn 117. navn Lv 1 1 pt. 8,220
  8. Avatar for pandapharmd 118. pandapharmd Lv 1 1 pt. 8,212
  9. Avatar for Fat Tony 119. Fat Tony Lv 1 1 pt. 8,204
  10. Avatar for Kiwegapa 120. Kiwegapa Lv 1 1 pt. 8,189

Comments