Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 7,353
  2. Avatar for Window Group 22. Window Group 1 pt. 4,069

  1. Avatar for tweak64 121. tweak64 Lv 1 1 pt. 8,180
  2. Avatar for ripples2288 122. ripples2288 Lv 1 1 pt. 8,161
  3. Avatar for katling 123. katling Lv 1 1 pt. 8,126
  4. Avatar for leehaggis 124. leehaggis Lv 1 1 pt. 8,107
  5. Avatar for darioarena 125. darioarena Lv 1 1 pt. 8,106
  6. Avatar for bullmoose3 126. bullmoose3 Lv 1 1 pt. 8,104
  7. Avatar for FishKAA 127. FishKAA Lv 1 1 pt. 8,085
  8. Avatar for Imeturoran 128. Imeturoran Lv 1 1 pt. 8,079
  9. Avatar for AeonFluff 129. AeonFluff Lv 1 1 pt. 8,071
  10. Avatar for Iron pet 130. Iron pet Lv 1 1 pt. 8,067

Comments