Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 7,353
  2. Avatar for Window Group 22. Window Group 1 pt. 4,069
  1. Avatar for Superphosphate 151. Superphosphate Lv 1 1 pt. 7,747
  2. Avatar for marcelkappes 152. marcelkappes Lv 1 1 pt. 7,710
  3. Avatar for jermainiac 153. jermainiac Lv 1 1 pt. 7,693
  4. Avatar for felipesua 154. felipesua Lv 1 1 pt. 7,655
  5. Avatar for parsnip 155. parsnip Lv 1 1 pt. 7,636
  6. Avatar for inlinesk8er 156. inlinesk8er Lv 1 1 pt. 7,627
  7. Avatar for Viperx99 157. Viperx99 Lv 1 1 pt. 7,594
  8. Avatar for Datstandin 158. Datstandin Lv 1 1 pt. 7,576
  9. Avatar for badgoes 159. badgoes Lv 1 1 pt. 7,567
  10. Avatar for JohnCena 160. JohnCena Lv 1 1 pt. 7,566

Comments