Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 7,353
  2. Avatar for Window Group 22. Window Group 1 pt. 4,069
  1. Avatar for crpainter 21. crpainter Lv 1 57 pts. 9,230
  2. Avatar for guineapig 22. guineapig Lv 1 56 pts. 9,229
  3. Avatar for Ikuso 23. Ikuso Lv 1 54 pts. 9,228
  4. Avatar for reefyrob 24. reefyrob Lv 1 52 pts. 9,221
  5. Avatar for mimi 25. mimi Lv 1 51 pts. 9,216
  6. Avatar for joremen 26. joremen Lv 1 49 pts. 9,209
  7. Avatar for Museka 27. Museka Lv 1 48 pts. 9,204
  8. Avatar for nicobul 28. nicobul Lv 1 46 pts. 9,191
  9. Avatar for hpaege 29. hpaege Lv 1 45 pts. 9,187
  10. Avatar for dcrwheeler 30. dcrwheeler Lv 1 44 pts. 9,181

Comments