Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 7,353
  2. Avatar for Window Group 22. Window Group 1 pt. 4,069

  1. Avatar for gmn 31. gmn Lv 1 42 pts. 9,176
  2. Avatar for shettler 32. shettler Lv 1 41 pts. 9,172
  3. Avatar for kabubi 33. kabubi Lv 1 40 pts. 9,166
  4. Avatar for phi16 34. phi16 Lv 1 38 pts. 9,156
  5. Avatar for JayD7217 35. JayD7217 Lv 1 37 pts. 9,153
  6. Avatar for johnmitch 36. johnmitch Lv 1 36 pts. 9,151
  7. Avatar for Norrjane 37. Norrjane Lv 1 35 pts. 9,134
  8. Avatar for Skippysk8s 38. Skippysk8s Lv 1 34 pts. 9,131
  9. Avatar for Blipperman 39. Blipperman Lv 1 33 pts. 9,126
  10. Avatar for Deleted player 40. Deleted player pts. 9,123

Comments