Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 7,353
  2. Avatar for Window Group 22. Window Group 1 pt. 4,069
  1. Avatar for NinjaGreg 61. NinjaGreg Lv 1 15 pts. 9,019
  2. Avatar for deLaCeiba 62. deLaCeiba Lv 1 14 pts. 9,003
  3. Avatar for alwen 63. alwen Lv 1 14 pts. 8,993
  4. Avatar for pfirth 64. pfirth Lv 1 13 pts. 8,987
  5. Avatar for isaksson 65. isaksson Lv 1 13 pts. 8,984
  6. Avatar for gurch 66. gurch Lv 1 12 pts. 8,971
  7. Avatar for dbuske 67. dbuske Lv 1 12 pts. 8,966
  8. Avatar for stomjoh 68. stomjoh Lv 1 11 pts. 8,949
  9. Avatar for randomlil 69. randomlil Lv 1 11 pts. 8,948
  10. Avatar for Scopper 70. Scopper Lv 1 11 pts. 8,942

Comments