Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 7,353
  2. Avatar for Window Group 22. Window Group 1 pt. 4,069

  1. Avatar for Bushman 71. Bushman Lv 1 10 pts. 8,928
  2. Avatar for TomTaylor 72. TomTaylor Lv 1 10 pts. 8,901
  3. Avatar for snakeguy 73. snakeguy Lv 1 9 pts. 8,878
  4. Avatar for Deleted player 74. Deleted player pts. 8,874
  5. Avatar for cbwest 75. cbwest Lv 1 9 pts. 8,862
  6. Avatar for Merf 76. Merf Lv 1 8 pts. 8,854
  7. Avatar for Deleted player 77. Deleted player pts. 8,849
  8. Avatar for ManVsYard 78. ManVsYard Lv 1 8 pts. 8,847
  9. Avatar for uihcv 79. uihcv Lv 1 7 pts. 8,817
  10. Avatar for tallguy-13088 80. tallguy-13088 Lv 1 7 pts. 8,746

Comments