Placeholder image of a protein
Icon representing a puzzle

1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 7,353
  2. Avatar for Window Group 22. Window Group 1 pt. 4,069

  1. Avatar for O Seki To 81. O Seki To Lv 1 7 pts. 8,746
  2. Avatar for Jesse Pinkman 82. Jesse Pinkman Lv 1 6 pts. 8,745
  3. Avatar for alcor29 83. alcor29 Lv 1 6 pts. 8,696
  4. Avatar for andrewxc 84. andrewxc Lv 1 6 pts. 8,678
  5. Avatar for lamoille 85. lamoille Lv 1 6 pts. 8,662
  6. Avatar for kvasirthewise 86. kvasirthewise Lv 1 5 pts. 8,659
  7. Avatar for SKSbell 87. SKSbell Lv 1 5 pts. 8,622
  8. Avatar for cjreinholt 88. cjreinholt Lv 1 5 pts. 8,591
  9. Avatar for cobaltteal 89. cobaltteal Lv 1 5 pts. 8,588
  10. Avatar for ViJay7019 90. ViJay7019 Lv 1 4 pts. 8,581

Comments