1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Summary

• Created: January 11, 2017
• Expires: January 18, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

• 1. Contenders 100 pts. 9,340
• 2. Beta Folders 79 pts. 9,331
• 3. Anthropic Dreams 61 pts. 9,311
• 4. Go Science 47 pts. 9,309
• 5. Gargleblasters 35 pts. 9,284
• 6. L'Alliance Francophone 26 pts. 9,275
• 7. Void Crushers 19 pts. 9,248
• 8. Kotocycle 14 pts. 9,228
• 9. Deleted group pts. 9,033
• 10. Italiani Al Lavoro 7 pts. 9,003

Top soloists

• 11. markm457 76 pts. 9,260
• 12. ZeroLeak7 74 pts. 9,256
• 13. Bletchley Park 72 pts. 9,254
• 14. Deleted player pts. 9,250
• 15. Timo van der Laan 68 pts. 9,248
• 16. actiasluna 66 pts. 9,246
• 17. Vredeman 64 pts. 9,242
• 18. pvc78 63 pts. 9,235
• 19. pauldunn 61 pts. 9,232
• 20. smilingone 59 pts. 9,232