1327: Revisiting Puzzle 84: Giant Anemone

Closed since about 9 years ago

Summary

• Created: January 11, 2017
• Expires: January 18, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

• 1. Contenders 100 pts. 9,340
• 2. Beta Folders 79 pts. 9,331
• 3. Anthropic Dreams 61 pts. 9,311
• 4. Go Science 47 pts. 9,309
• 5. Gargleblasters 35 pts. 9,284
• 6. L'Alliance Francophone 26 pts. 9,275
• 7. Void Crushers 19 pts. 9,248
• 8. Kotocycle 14 pts. 9,228
• 9. Deleted group pts. 9,033
• 10. Italiani Al Lavoro 7 pts. 9,003

Top soloists

• 51. Jim Fraser 22 pts. 9,077
• 52. Crossed Sticks 21 pts. 9,072
• 53. WBarme1234 20 pts. 9,068
• 54. gdnskye 19 pts. 9,056
• 55. jamiexq 19 pts. 9,054
• 56. caglar 18 pts. 9,039
• 57. drumpeter18yrs9yrs 17 pts. 9,033
• 58. hansvandenhof 17 pts. 9,028
• 59. Glen B 16 pts. 9,022
• 60. diamonddays 16 pts. 9,020